загрузка...

трусы женские
загрузка...
Реферати » Реферати з біології та хімії » Спадкування груп крові резус

Спадкування груп крові резус

На малюнку представлено положення резус білка резус в мембрані еритроцитів.

Наследование групп крови резус

Чому він так названий? У 30-40-х роках, коли досить інтенсивно проводилися дослідження груп крові, було виявлено, що антитіла до групи крові мавпи резус агглютинируют у деяких людей їх еритроцити.

Аглютинація - це процес склеювання еритроцитів під дією антитіл до Белам, розташованим на мембранах еритроцитів. На малюнку нижче представлений картина аглютинації. Тут зображені крапельки крові, до яких додана сироватка, що містить антитіла до резус-білку. Синім обведені краплі, в яких з кров'ю нічого не відбувається. Якщо реакція при додаванні антитіл не йде, то, значить у даної людини резус-білок відсутній. Червоним обведені зразки крові, в яких відбувається аглютинація. Літерами позначені краплі крові, які реакцію дають, але дуже слабку. Таке зустрічається у приблизно 1% людей, і це так і званий слабкий резус фенотип.

Наследование групп крови резус

З чим це пов'язано? На малюнку нижче літерами представлена ??послідовність резус-білка. Ви знаєте, що білок складається з 20 амінокислот, кожна з яких позначається своєї буквою. Ген (послідовність нуклеотидів, відповідно, в 3 рази довша послідовність, записана тільки четиремя буквами, а не 20), який кодує резус-білок, називається RHD.

Амінокислотноїпослідовності РЕЗУС-БІЛКА ЛЮДИНИ

(кожна амінокислота позначена однією буквою):

Інформація з бази даних NCBI

Human RhD blood group antigen mRNA, complete cds

ORGANISM Homo sapiens

standard_name = "RhD"

MSSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQV

GQDLTVMAAIGLGFLTSSFRRHSWSSVAFNLFMLALGVQWAILLDGFLSQ

FP SGKVVITLFSIRLATMSALSVLISVDAVLGKVNLAQLVVMVLVEVTA

LGNLRMVISNIFNTDYHMNMMHIYVFAAYFGLSVAWCLPKPLPEGTEDKD

QTATIPSLSAMLGALFLWMFWPSFNSALLRSPIERKNAVFNTYYAVAVSV

VTAISGSSLAHPQGKISKTYVHSAVLAGGVAVGTSCHLIPSPWLAMVLGL

VAGLISVGGAKYLPGCCNRVLGIPHSSIMGYNFSLLGLLGEIIYIVLLVL

DTVGAGNGMIGFQVLLSIGELSLAIVIALTSGLLTGLLLNLKIWKAPHEA

KYFDDQVFWKFPHLAVGF

ПОСЛІДОВНІСТЬ нуклеотидів кодують ЧАСТИНИ ГЕНА РЕЗУС-БІЛКА ЛЮДИНИ

Інформація з бази даних NCBI

1 atgagctcta agtacccgcg gtctgtccgg cgctgcctgc ccctctgggc cctaacactg
61 gaagcagctc tcattctcct cttctatttt tttacccact atgacgcttc cttagaggat
121 caaaaggggc tcgtggcatc ctatcaagtt ggccaagatc tgaccgtgat ggcggccatt
181 ggcttgggct tcctcacctc gagtttccgg agacacagct ggagcagtgt ggccttcaac
241 ctcttcatgc tggcgcttgg tgtgcagtgg gcaatcctgc tggacggctt cctgagccag
301 ttcccttctg ggaaggtggt catcacactg ttcagtattc ggctggccac catgagtgct
361 ttgtcggtgc tgatctcagt ggatgctgtc ttggggaagg tcaacttggc gcagttggtg
421 gtgatggtgc tggtggaggt gacagcttta ggcaacctga ggatggtcat cagtaatatc
481 ttcaacacag actaccacat gaacatgatg cacatctacg tgttcgcagc ctattttggg
541 ctgtctgtgg cctggtgcct gccaaagcct ctacccgagg gaacggagga taaagatcag
601 acagcaacga tacccagttt gtctgccatg ctgggcgccc tcttcttgtg gatgttctgg
661 ccaagtttca actctgctct gctgagaagt ccaatcgaaa ggaagaatgc cgtgttcaac
721 acctactatg ctgtagcagt cagcgtggtg acagccatct cagggtcatc cttggctcac
781 ccccaaggga agatcagcaa gacttatgtg cacagtgcgg tgttggcagg aggcgtggct
841 gtgggtacct cgtgtcacct gatcccttct ccgtggcttg ccatggtgct gggtcttgtg
901 gctgggctga tctccgtcgg gggagccaag tacctgccgg ggtgttgtaa ccgagtgctg
961 gggattcccc acagctccat catgggctac aacttcagct tgctgggtct gcttggagag
1021 atcatctaca ttgtgttgct ggtgcttgat accgtcggag ccggcaatgg catgattggc
1081 ttccaggtcc tcctcagcat tggggaactc agcttggcca tcgtgatagc tctcacgtct
1141 ggtctcctga caggtttgct cctaaatctt aaaatatgga aagcacctca tgaggctaaa
1201 tattttgatg accaagtttt ctggaagttt cctcatttgg ctgttggatt ttaagcaaaa
1261 gcatccaaga aaaacaaggc ctgttcaaaa acaagacaac ttcctctcac tgttgcctgc
1321 atttgtacgt gagaaacgct catgacagca aagt / /

У більшості людей (85%) є ген резус-фактора, але у 15% цей ген відсутній, відсутній відповідний гену нуклеотидний "текст". Якщо цей ген присутній, то він визначає у людини синтез резус-білка. Якщо ж його немає, то резус-білок не синтезується.

Такі різні "стану" гена - варіації нуклеотидного "тексту" називаються альтернативними формами або коротко-алелями. У даному випадку варіація - це наявність або відсутність всієї нуклеотидної послідовності гена.

У людини може зустрічатися 3 варіанти поєднання резус-алелей. Людина, у якої 2 алелі з присутнім геном, має групу крові резус позитивну (рис. 4 вгорі). Якщо у людини на одній з хромосом ген відсутній, то білок все одно синтезується з гена на другий хромосомі; і резус-група також позитивна (мал. в середині). Білок не синтезується тільки в тому випадку, коли ген відсутній на обох хромосомах. Тільки в цьому випадку група крові резус-негативна (рис. 4 внизу).

Наследование групп крови резус

Питання, що був заданий, описував ситуацію, коли обоє батьків мають два різних алелі. Тобто обидва вони резус-позитивні, але другий аллель у них не містить послідовність, що кодує резус-білок. І обидва їх дитини отримали від кожного з батьків якраз цей аллель з відсутнім геном. Нескладно розрахувати ймовірність народження в такій сім'ї дитини з негативним резус-фактором. Вона дорівнює 25% (1/2 * 1/2 = 1/4); ймовірність ж народження обох дітей з резус-негативної групою крові - 1/16.

Варто згадати про резус-конфлікті. Його суть полягає в наступному. Якщо мати резус-негативна, її чоловік резус-позитивний, і дитина успадковує від батька Rh +, то в крові матері можуть почати вироблятися антитіла проти резус-фактора плоду. При першій вагітності цього зазвичай не відбувається, але при пологах можливий контакт з білками крові дитини, і у матері можуть з'явитися в крові антитіла до резус-фактору. Тоді при наступній вагітності резус-позитивним плодом материнські антитіла зруйнують еритроцити дитини. Це захворювання називається гемолітична жовтяниця (дитина народжується весь жовтий і зазвичай незабаром вмирає). Описано це захворювання вперше в 1609 році французькою акушеркою. Коли була розроблена процедура переливання крові, то таких дітей навчилися рятувати. Їм робили штучне переливання крові, тобто повністю зливали всю їх кров, і вводили нову. Тепер, коли встановлені причини резус-конфлікту, поступають таким чином. Якщо під час вагітності, у жінки кров резус-негативна, а у чоловіка резус-позитивна, стежать за рівнем антитіл до резус-фактору і проводять необхідне лікування, якщо титр цих антитіл починає зростати. Варто відзначити, що якщо мати резус-позитивна, а сама дитина резус-негативний, то конфлікту не відбувається.

Я б хотіла відзначити один з отриманих відповідей на це питання. Коли ми складали питання для лекцій, ми отримали реальний питання з газети «АиФ» з проханням роз'яснити, в чому справа. Ми вирішили включити це питання до опитувальника, з метою перевірити, наскільки наші слухачі знайомі з генетикою. Власне, питання передбачався як чисто навчальний. І ось одна з відповідей був наступним: «Я б не ризикнув відповідати на це питання, так як я не фахівець, а від моєї відповіді залежить сімейне щастя людини» . Хочеться висловити повагу людині, яка так відповів на питання, тому що він сприйняв контекст, в якому стояла чисто навчальне завдання. Він продемонстрував розуміння етичних аспектів, пов'язаних з наукою. Я думаю, ви розумієте, що існує відповідальність вченого, і чудово, що у вашій аудиторії є люди, які вже зараз настільки ясно розуміють зв'язок науки з реальним життям.

 
Подібні реферати:
Генетика людини
Інтерес до вивчення генетики людини останнім часом особливо зріс внаслідок різкого збільшення кількості мутагенів (хімічні речовини, радіація). Кількість спадкових патологій за останні 20 років зросла в кілька разів.
Геногеографія - шлях в наше минуле
"Геногеографія" позначає нову наукову область на перетині проблем генетики, географії, еволюції та історії.
Спадковість
Носії спадковості. Спадкування аутосомних ознак. Спадкування підлоги і зчеплених зі статтю ознак. Спадкування підлоги і зчеплених зі статтю ознак.
Методи генетики
Генеалогічний метод. Популяційний метод. Близнюковий метод. Цитогенетичний метод. Біохімічний метод.
Функції білків
Нижче розглядаються головні і в деякому розумінні унікальні біологічні функції білків, невластиві або лише частково властиві іншим класам біополімерів.
Водневий показник ... Людини
Відомо, що кров здорової людини має рН 7,3-7,4. Точніше, плазма крові має рН близько 7,36 - тобто концентрація катіонів оксония H3O + тут ??становить 4,4. 10-8 моль / л.
Імунітет
Імунітет, здатність організму людини і тварин специфічно реагувати на присутність у ньому якоїсь речовини, зазвичай чужорідного. Ця реакція на чужорідні речовини забезпечує опірність організму.
Білки
Білки складаються з мономерів - амінокислот. Кожна амінокислота має аминогруппу, пов'язану з атомом вуглецю, з цим же атомом пов'язана карбоксильная група, водень і амінокислотний залишок. Така конфігурація присутній у всіх амінокислотах.
Опції клітин
Клітка покрита мембраною, що складається з декількох шарів молекул, що забезпечує виборчу проникність речовин.
Інсулін
Інсулін, білковий гормон, що виробляється підшлунковою залозою і регулює рівень цукру (глюкози) у крові; препарати інсуліну застосовуються для лікування цукрового діабету.
Біохімія
Біохімічні концепції знаходять застосування в медицині, харчовій, фармацевтичній та мікробіологічної промисловості, сільському господарстві, а також у переробній промисловості.
Моноклональні антитіла
Практичне застосування антитіл і про способи їх отримання. При введенні в організм тварин і людини чужорідних макромолекулярних речовин - білків або полісахаридів (антигенів) в крові з'являються захисні білки - антитіла.
Методи визначення С-кінцевої амінокислоти
Для визначення природи С-кінцевої амінокислоти часто використовують ферментативні методи. Обробка поліпептиду карбоксипептидази, яка розриває пептидную зв'язок з того кінця пептиду, де міститься вільна СООН-група.
Нуклеїнові кислоти
Нуклеїнові кислоти - фосфорсодержащие біополімери живих організмів, що забезпечують зберігання та передачу спадкової інформації. Вони були відкриті в 1869 р. швейцарським біохіміком Ф. Мишером в ядрах лейкоцитів, сперматозоїдів лосося.
Вміст білків в органах і тканинах
Найбільш багаті білковими речовинами тканини і органи тварин. Джерелом білка є також мікроорганізми і рослини. Більшість білків добре розчинно у воді.
Білки
Амінокислоти - структурні компоненти белков.Белкі, або протеїни (грец. protos - першорядний), - це біологічні гетерополімери, мономерами яких є амінокислоти.
Білки
Це лінійні біополімери складаються з періодичних мономерів (альфа амінокислот). Всі 10 000 білків утворені 20 амінокислотами.
Генетика популяцій
Популяційна генетика. Генофонд. Частоти алелів. Частота генотипів. Рівняння Харді-Вайнберга. Слідство рівняння Харді-Вайнберга. Чинники, що викликають зміни в популяціях.
Білки
Білки (протеїни), клас складних азотовмісних сполук, найбільш характерних і важливих (поряд з нуклеїновими кислотами) компонентів живої речовини. Білки виконують численні та різноманітні функції.
Синтез ДНК, РНК і білків
Синтез ДНК називається реплікацією або редуплікацією (подвоєнням), синтез РНК - транскрипцією (переписування з ДНК), синтез білка, що проводиться рибосомой на матричної РНК називається трансляцією, тобто перекладаємо з мови нуклеотидів на мову амінокислот.
загрузка...
ur.co.ua

енциклопедія  з сиру  аджапсандалі  ананаси  узвар